- Recombinant Inner membrane protein yjiG (yjiG)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1036996
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 16,193 Da
- E Coli or Yeast
- Inner membrane protein yjiG (yjiG)
- 1-153
Sequence
MTTQVRKNVMDMFIDGARRGFTIATTNLLPNVVMAFVIIQALKITGLLDWVGHICEPVMALWGLPGEAATVLLAALMSMGGAVGVAASLATAGALTGHDVTVLLPAMYLMGNPVQNVGRCLGTAEVNAKYYPHIITVCVINALLSIWVMQLIV